UGCG Rabbit Polyclonal Antibody

• Catalog Number: orb578345
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UGCG
• Target: UGCG
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UGCG
• Protein Sequence: Synthetic peptide located within the following region: LHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVL
• UniProt ID: Q16739
• MW: 45 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GCS, GLCT1
• Note: For research use only
• NCBI: NP_003349

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/ml.

Positive control (+): Human spleen (SP), Negative control (-): THP-1 (N30), Antibody concentration: 1 ug/ml.

WB Suggested Anti-UGCG Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Spleen.