You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584287 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to UCHL5 |
Target | UCHL5 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human UCHL5 |
Protein Sequence | Synthetic peptide located within the following region: KRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK |
UniProt ID | Q9Y5K5 |
MW | 37kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | UCH37, CGI-70, INO80R, UCH-L5 |
Note | For research use only |
NCBI | NP_057068 |
Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-UCHL5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-Fr, WB | |
Porcine | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |