UCHL5 Rabbit Polyclonal Antibody

SKU: orb583318

Description

Rabbit polyclonal antibody to UCHL5

Research Area

Epigenetics & Chromatin, Molecular Biology, Protein Biochemistry

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Zebrafish
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UCHL5
• Target: UCHL5
• Protein Sequence: Synthetic peptide located within the following region: DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK
• Molecular Weight: 38 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

UCH37, CGI-70, INO80R, UCH-L5

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Peptide is also present in some higher mw isoforms including 45 kDa, and the protein may be modified by acetylation or succinylation.

WB Suggested Anti-UCHL5 Antibody, Positive Control: Lane 1: 30 ug Zebrafish skin lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody dilution: 1:4000.

WB Suggested Anti-UCHL5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Small Intestine.

Quick Database Links

Gene Symbol

UCHL5

UniProt

Q9Y5K5

RefSeq (Protein):NP_057068