You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585092 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to UBE2V1 |
Target | UBE2V1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: GEVQASYLKSQSKLSDEGRLEPRKFHCKGVKVPRNFRLLEELEEGQKGVG |
UniProt ID | Q13404 |
MW | 19kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CIR1, UEV1, CROC1, UBE2V, UEV-1, UEV1A, CROC-1 |
Note | For research use only |
NCBI | NP_068823 |
WB Suggested Anti-UBE2V1 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Liver.
FC, IF, IHC-Fr, IHC-P | |
Equine, Gallus, Mouse, Porcine, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Other, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF | |
Equine, Gallus, Mouse, Porcine, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
PE/Cy7 |