You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb585092 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to UBE2V1 |
| Target | UBE2V1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Protein Sequence | Synthetic peptide located within the following region: GEVQASYLKSQSKLSDEGRLEPRKFHCKGVKVPRNFRLLEELEEGQKGVG |
| UniProt ID | Q13404 |
| MW | 19kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CIR1, UEV1, CROC1, UBE2V, UEV-1, UEV1A, CROC-1 |
| Research Area | Cancer Biology, Cell Biology, Epigenetics & Chroma Read more... |
| Note | For research use only |
| NCBI | NP_068823 |
| Expiration Date | 12 months from date of receipt. |

WB Suggested Anti-UBE2V1 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Liver.
FC, IF, IHC-Fr, IHC-P | |
Equine, Gallus, Mouse, Porcine, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Other, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |