UBE2V1 Rabbit Polyclonal Antibody

• Catalog Number: orb585091
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UBE2V1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 16kDa
• Target: UBE2V1
• UniProt ID: Q13404
• Protein Sequence: Synthetic peptide located within the following region: GVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN
• NCBI: NP_001027459
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CIR1, UEV1, CROC1, UBE2V, UEV-1, UEV1A, CROC-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-UBE2V1 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Brain.