UBE2L6 Rabbit Polyclonal Antibody

• Catalog Number: orb578691
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UBE2L6
• Target: UBE2L6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UBE2L6
• Protein Sequence: Synthetic peptide located within the following region: QVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRP
• UniProt ID: O14933
• MW: 18kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: RIG-B, UBCH8
• Note: For research use only
• NCBI: NP_004214

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 3 ug/ml.

WB Suggested Anti-UBE2L6 Antibody, Positive Control: Lane 1: 70 ug U6A lysate, Lane, 2: 70 ug IFN-g stimulated U6A lysate, Primary Antibody Dilution: 1:2000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:5000.

WB Suggested Anti-UBE2L6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Small Intestine.