TYRP1 Rabbit Polyclonal Antibody

• Catalog Number: orb325137
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TYRP1
• Target: TYRP1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TYRP1
• Protein Sequence: Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP
• UniProt ID: P17643
• MW: 61 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CAS2 antibody, anti CATB antibody, anti GP75
• Note: For research use only
• NCBI: NP_000541

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Protein is expressed as 61 kDa preprotein and is processed to approximately 56 kDa. It is also highly glycosylated.

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human 786-0, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Type: Human 721_B, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5.0 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%.

Rabbit Anti-TYRP1 Antibody, Paraffin Embedded Tissue: Human Skin, Antibody Concentration: 5 ug/mL.

WB Suggested Anti-TYRP1 Antibody Titration: 1 ug/mL, Positive Control: 721_B cell lysate.