TYRP1 Rabbit Polyclonal Antibody

• Catalog Number: orb325135
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TYRP1
• Target: TYRP1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Porcine, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TYRP1
• Protein Sequence: Synthetic peptide located within the following region: AKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTF
• UniProt ID: P17643
• MW: 59kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CAS2 antibody, anti CATB antibody, anti GP75
• Note: For research use only
• NCBI: NP_000541

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-TYRP1 Antibody Titration: 2.5 ug/mL, Positive Control: Jurkat cell lysate.