You have no items in your shopping cart.
[Tyr34] Parathyroid Hormone (7-34), amide, bovine
SKU: orb2693868
Description
Images & Validation
−![[Tyr34] Parathyroid Hormone (7-34), amide, bovine](/images/quality_badge_proteins.png){kind=icon}
Key Properties
−| Target | others |
|---|---|
| Molecular Weight | 3496.03 |
| Protein Sequence | FMHNLGKHLSSMERVEWLRKKLQDVHNY-NH2 |
| Purity | ≥95% |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−
(D-Trp12,Tyr34)-pTH (7-34) amide (bovine) acetate [orb1297945]
10 mg, 25 mg, 50 mg, 200 mg, 1 mg, 5 mg, 100 mg(D-Trp12,Tyr34)-pTH (7-34) amide (bovine) [orb3053989]
>98% (HPLC)
118102-98-0
3625.25
C165H251N49O40S2
100 mg, 50 mg, 25 mg, 10 mg, 5 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
others
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
[Tyr34] Parathyroid Hormone (7-34), amide, bovine (orb2693868)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days