TUBB3 Rabbit Polyclonal Antibody

• Catalog Number: orb585768
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Tubulin beta 3
• Target: TUBB3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: LHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEES
• UniProt ID: Q13509
• MW: 50kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CDCBM, FEOM3, TUBB4, CDCBM1, CFEOM3, beta-4, CFEOM
• Research Area: Cell Biology, Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_006077

TUBB3 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb585768 with 1:200 dilution. Western blot was performed using orb585768 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: TUBB3 IP with orb585768 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-TUBB3 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Heart.