TUBB2B Rabbit Polyclonal Antibody

• Catalog Number: orb586400
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TUBB2B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Mouse, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TUBB2B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50 kDa
• Target: TUBB2B
• UniProt ID: Q9BVA1
• Protein Sequence: Synthetic peptide located within the following region: GGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSV
• NCBI: NP_821080
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CDCBM7, PMGYSA, bA506K6.1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-TUBB2B Antibody, Titration: 1.0 ug/ml, Positive Control: MCF7 Whole Cell.