You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
TSPAN32 Rabbit Polyclonal Antibody
Catalog Number: orb325285
| Catalog Number | orb325285 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TSPAN32 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IHC, WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TSPAN32 |
| Concentration | 1.0 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 31kDa |
| Target | TSPAN32 |
| UniProt ID | Q96QS1 |
| Protein Sequence | Synthetic peptide located within the following region: YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR |
| NCBI | NP_005696 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti MGC22455 antibody, anti PHEMX antibody, anti Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Human Liver
WB Suggested Anti-TSPAN32 Antibody Titration: 5.0 ug/mL, Positive Control: Jurkat cell lysate.
- Item 1 of 1
- Item 1 of 1
ART1 Rabbit Polyclonal Antibody [orb158143]
IF, IHC-Fr, IHC-P
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl 
