Cart summary

You have no items in your shopping cart.

TSPAN32 Rabbit Polyclonal Antibody (Biotin)

TSPAN32 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2116597

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2116597
CategoryAntibodies
DescriptionTSPAN32 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TSPAN32
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW31kDa
UniProt IDQ96QS1
Protein SequenceSynthetic peptide located within the following region: YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR
NCBINP_005696
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesART1, PHMX, PHEMX, TSSC6
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.