You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324688 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Tsc22d4 |
Target | Tsc22d4 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Bovine, Guinea pig, Human, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse Tsc22d4 |
Protein Sequence | Synthetic peptide located within the following region: VAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSML |
UniProt ID | Q99PD5 |
MW | 40kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti 0610009M14Rik antibody, anti 1700023B23Rik an Read more... |
Note | For research use only |
NCBI | NP_076399 |
WB Suggested Anti-Tsc22d4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Mouse Thymus.
IHC, WB | |
Canine, Guinea pig, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |