Tsc22d4 Rabbit Polyclonal Antibody

• Catalog Number: orb324688
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Tsc22d4
• Target: Tsc22d4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Guinea pig, Human, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Tsc22d4
• Protein Sequence: Synthetic peptide located within the following region: VAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSML
• UniProt ID: Q99PD5
• MW: 40kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti 0610009M14Rik antibody, anti 1700023B23Rik an
• Note: For research use only
• NCBI: NP_076399

WB Suggested Anti-Tsc22d4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Mouse Thymus.