TSC22D4 Rabbit Polyclonal Antibody

• Catalog Number: orb324362
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TSC22D4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Guinea pig, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TSC22D4
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 41kDa
• Target: TSC22D4
• UniProt ID: Q9Y3Q8
• Protein Sequence: Synthetic peptide located within the following region: SGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPPTGPPPRLPNGEPSPD
• NCBI: NP_112197
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti THG1 antibody, anti THG-1 antibody, anti TILZ
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-TSC22D4 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

Rabbit Anti-TSC22D4 Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Alveolar cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-TSC22D4 Antibody Titration: 0.5 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.