TRPM2 Rabbit Polyclonal Antibody

• Catalog Number: orb579153
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TRPM2
• Target: TRPM2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM2
• Protein Sequence: Synthetic peptide located within the following region: VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK
• UniProt ID: O94759
• MW: 171kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: KNP3, EREG1, TRPC7, LTRPC2, NUDT9H, LTrpC-2, NUDT9
• Research Area: Cell Biology, Immunology & Inflammation, Signal Tr
• Note: For research use only
• NCBI: NP_003298

Anti-TRPM2 antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody orb579153 concentration 10 ug/ml.

Anti-TRPM2 antibody IHC of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody orb579153 concentration 10 ug/ml.

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

TRPM2 antibody - N-terminal region (orb579153) validated by WB using Fetal Brain Lysate at 1 ug/ml.