CLU Rabbit Polyclonal Antibody

• Catalog Number: orb584908
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CLU
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Equine, Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CLU
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58kDa
• Target: CLU
• UniProt ID: P10909
• Protein Sequence: Synthetic peptide located within the following region: CREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLN
• NCBI: NP_001822
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CLI, AAG4, APOJ, CLU1, CLU2, KUB1, SGP2, APO-J, SG
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CLU antibody - C-terminal region (orb584908) validated by WB using Fetal Brain Lysate at 1 ug/ml.

equine cartilage explants.

Lanes: 1. 40 ug human HK2 cell (kidney proximal tubular cell line) lysate, 2. 40 ug H2O2 treated human HK2 Cell lysate, 3. 40 ug H2O2 treated human HK2 Cell lysate, 4. 40 ug H2O2 treated human HK2 Cell lysate, 5. 40 ug H2O2 treated human HK2 Cell lysate, 6. 40 ug H2O2 treated human HK2 Cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit HRP, Secondary Antibody dilution: 1:2000, Gene Name: CLU.

Rabbit Anti-CLU Antibody, Catalog Number: orb584908, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-CLU Antibody, Catalog Number: orb584908, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.