You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575077 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TRIM10 |
Target | TRIM10 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM10 |
Protein Sequence | Synthetic peptide located within the following region: RVSLDYEVGWVTFTNAVTREPIYTFTASFTRKVIPFFGLWGRGSSFSLSS |
UniProt ID | Q9UDY6 |
MW | 55kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | RNF9, HERF1, RFB30 |
Note | For research use only |
NCBI | NP_006769 |
Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 5 ug/ml.
Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that TRIM10 is expressed in 721_B.
Sample Type: Hela, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Kidney, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml.
Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-TRIM10 Antibody Titration: 5.0 ug/ml, ELISA Titer: 1:2500, Positive Control: HepG2 cell lysate, There is BioGPS gene expression data showing that TRIM10 is expressed in HepG2.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Biotin |