You have no items in your shopping cart.
TRIM10 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM10 |
| Target | TRIM10 |
| Protein Sequence | Synthetic peptide located within the following region: RVSLDYEVGWVTFTNAVTREPIYTFTASFTRKVIPFFGLWGRGSSFSLSS |
| Molecular Weight | 55kDa |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−TRIM10 Rabbit Polyclonal Antibody [orb575078]
IHC, WB
Bovine, Canine, Equine, Guinea pig, Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μlTRIM10 Rabbit Polyclonal Antibody [orb583742]
WB
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μlTRIM10 Rabbit Polyclonal Antibody (HRP) [orb2100950]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat
Rabbit
Polyclonal
HRP
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 5 ug/ml.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that TRIM10 is expressed in 721_B.

Sample Type: Hela, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Kidney, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-TRIM10 Antibody Titration: 5.0 ug/ml, ELISA Titer: 1:2500, Positive Control: HepG2 cell lysate, There is BioGPS gene expression data showing that TRIM10 is expressed in HepG2.
Documents Download
Request a Document
TRIM10 Rabbit Polyclonal Antibody (orb575077)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








