TRIM10 Rabbit Polyclonal Antibody

• Catalog Number: orb575215
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TRIM10
• Target: TRIM10
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM10
• Protein Sequence: Synthetic peptide located within the following region: PNWQLANVVENIERLQLVSTLGLGEEDVCQEHGEKIYFFCEDDEMQLCVV
• UniProt ID: Q9UDY6
• MW: 55kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: RNF9, HERF1, RFB30
• Note: For research use only
• NCBI: NP_006769

Rabbit Anti-TRIM10 Antibody, Catalog Number: orb575215, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-TRIM10 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: PANC1 cell lysate, There is BioGPS gene expression data showing that TRIM10 is expressed in PANC1.

WB Suggested Anti-TRIM10 antibody Titration: 1 ug/ml, Sample Type: Human heart.

WB Suggested Anti-TRIM10 antibody Titration: 1 ug/ml, Sample Type: Human liver.