TRADD Rabbit Polyclonal Antibody

• Catalog Number: orb592664
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TRADD
• Target: TRADD
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRADD
• Protein Sequence: Synthetic peptide located within the following region: YEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGL
• UniProt ID: Q15628
• MW: 34kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Hs.89862
• Research Area: Cell Biology, Immunology & Inflammation, Signal Tr
• Note: For research use only
• NCBI: NP_003780
• Expiration Date: 12 months from date of receipt.

Lanes: Lane 1: 10 ug Tradd-HA-Strep-stable expression 293TREXFlpIn cells-Doxycycline induced, Lane 2: 10 ug ITradd-HA-Strep-stable expression 293TREXFlpIn cells-non-induced, Lane 3: 10 ug siRNA scrambled-MDA-MB-231 cells, Lane 4: siRNA Tradd-MDA-MB-231 cells, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:2000, Gene Name: TRADD. There is BioGPS gene expression data showing that TRADD is expressed in HEK293T.

WB Suggested Anti-TRADD Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: DU145 cell lysate. There is BioGPS gene expression data showing that TRADD is expressed in DU145.