Cart summary

You have no items in your shopping cart.

TRADD Rabbit Polyclonal Antibody (Biotin)

TRADD Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2081476

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2081476
CategoryAntibodies
DescriptionTRADD Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityCanine, Equine, Human
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TRADD
Protein SequenceSynthetic peptide located within the following region: YEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGL
UniProt IDQ15628
MW34kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesHs.89862
NoteFor research use only
NCBINP_003780