You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573633 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to p53 |
Target | TP53 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TP53 |
Protein Sequence | Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
UniProt ID | P04637 |
MW | 44 kDa |
Tested applications | ChIP, ELISA, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | P53, BCC7, LFS1, BMFS5, TRP53 |
Note | For research use only |
NCBI | NP_000537 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. TP53 is expressed as several different isoforms (> 10) ranging in size from 24 kDa to ~50 kDa in a cell type specific manner. This immunogen for this antibody is present in several isoforms. 1-3 ug/ml is recommended for this antibody.
DU145 cells were lysed in IP lysis buffer (20mM HEPES, 1% Triton X-100, 150mM NaCl, 1mMEDTA, 1mM EGTA, 100mM NaF, 10mM Na4P2O7, 1mM Na3VO4, 0.2mM PMSF). Amount of protein per well: 30 ug, Primary antibody conditions: 1:2000 in 5% milk/TBST buffer, overnight at 4°C.Secondary antibody conditions: 1:5000 in 5% milk/TBST buffer, 1 hour at room temperature. TP53 is strongly supported by BioGPS gene expression data to be expressed in Human DU145 cells.
Sample type: HeLa cells Antibody titration: 1 to 1000, Gel: 4-15% gradient, Secondary: Goat anti-rabbit HRP, Secondary dilution: 1 to 5000. TP53 is supported by BioGPS gene expression data to be expressed in HeLa.
U20S (p53+) cells were treated with 0.5 uM Doxorubicin for 14 hrs to induce DNA damage and hence activate p53. In parallel, PLKO cells (U2OS cells with stable shRNA-mediated knockdown of p53) were treated similarly and were used as negative control. Thedata for p21 promoter were normalised to actin (control for non-specific binding of DNA to the antibodies).
WB Suggested Anti-TP53 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T. TP53 is strongly supported by BioGPS gene expression data to be expressed in HEK293T.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P | |
Canine | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Equine | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Porcine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ChIP, IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |