TP53 Rabbit Polyclonal Antibody

• Catalog Number: orb573620
• Category: Antibodies
• Description: Rabbit polyclonal antibody to p53
• Target: TP53
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TP53
• Protein Sequence: Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP
• UniProt ID: P04637
• MW: 44kDa
• Tested applications: ChIP, ELISA, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: P53, BCC7, LFS1, BMFS5, TRP53
• Note: For research use only
• NCBI: NP_000537

Sample Type:human cystic fibrosis bronchial epithelial cells, P53: 1/1000Goat anti-rabbit-HRP: 1:5000.

U20S (p53+) cells were treated with 0.5 uM Doxorubicin for 14 hrs to induce DNA damage and hence activate p53. In parallel, PLKO cells (U2OS cells with stable shRNA-mediated knockdown of p53) were treated similarly and were used as negative control. Thedata for p21 promoter were normalised to actin (control for non-specific binding of DNA to the antibodies).

WB Suggested Anti-TP53 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, TP53 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.