TP53 Rabbit Polyclonal Antibody

• Catalog Number: orb573619
• Category: Antibodies
• Description: Rabbit polyclonal antibody to p53
• Target: TP53
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TP53
• Protein Sequence: Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
• UniProt ID: P04637
• MW: 44kDa
• Tested applications: ChIP, IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: P53, BCC7, LFS1, BMFS5, TRP53
• Note: For research use only
• NCBI: NP_000537

Kidney

Sample Type: human DU145 cells.

WB Suggested Anti-TP53 Antibody, Titration: 0.5 ug/ml, Positive Control: DU145 CELLS. TP53 is strongly supported by BioGPS gene expression data to be expressed in Human DU145 cells.

WB Suggested Anti-TP53 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.TP53 is strongly supported by BioGPS gene expression data to be expressed in HEK293T.