You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573619 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to p53 |
Target | TP53 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TP53 |
Protein Sequence | Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
UniProt ID | P04637 |
MW | 44kDa |
Tested applications | ChIP, IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | P53, BCC7, LFS1, BMFS5, TRP53 |
Note | For research use only |
NCBI | NP_000537 |
Kidney
Sample Type: human DU145 cells.
WB Suggested Anti-TP53 Antibody, Titration: 0.5 ug/ml, Positive Control: DU145 CELLS. TP53 is strongly supported by BioGPS gene expression data to be expressed in Human DU145 cells.
WB Suggested Anti-TP53 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.TP53 is strongly supported by BioGPS gene expression data to be expressed in HEK293T.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P | |
Canine | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Equine | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Porcine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ChIP, IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |