You have no items in your shopping cart.
TNFSF10 Peptide - middle region
SKU: orb1999256
Description
Research Area
Cell Biology
Images & Validation
−
Key Properties
−| Protein Sequence | Synthetic peptide located within the following region: SKSGIACFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEET |
|---|
Storage & Handling
−| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−TL2, APO2L, CD253, TRAIL, Apo-2L, TNLG6A
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
RefSeq (Protein):NP_001177871.1
UniProt Details
− No UniProt data available
NCBI Reference Sequences
−Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product| Protein | NP_001177871.1 |
|---|
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
TNFSF10 Peptide - middle region (orb1999256)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review