You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584989 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TNFAIP3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Canine, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human TNFAIP3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 51kDa |
Target | TNFAIP3 |
UniProt ID | P21580 |
Protein Sequence | Synthetic peptide located within the following region: QENSEQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHE |
NCBI | NP_001257436.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | A20, AISBL, OTUD7C, TNFA1P2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: ACHN Whole cell lysates, Antibody dilution: 1.0 ug/ml.
Rabbit Anti-TNFAIP3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Spleen, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Mouse, Porcine | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Human, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |