TMEM63A Rabbit Polyclonal Antibody

• Catalog Number: orb324898
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TMEM63A
• Target: TMEM63A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Guinea pig, Mouse, Rabbit, Rat, Yeast
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM63A
• Protein Sequence: Synthetic peptide located within the following region: MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP
• UniProt ID: O94886
• MW: 89kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti KIAA0489 antibody, anti KIAA0792 antibody, an
• Research Area: Cell Biology, Molecular Biology
• Note: For research use only
• NCBI: NP_055513

Positive control (+): Human stomach (ST), Negative control (-): Human liver (LI), Antibody concentration: 0.5 ug/mL.

WB Suggested Anti-TMEM63A Antibody Titration: 0.2-1 ug/mL, Positive Control: 293T cell lysate.