You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324898 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TMEM63A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Guinea pig, Mouse, Rabbit, Rat, Yeast |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM63A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 89kDa |
Target | TMEM63A |
UniProt ID | O94886 |
Protein Sequence | Synthetic peptide located within the following region: MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP |
NCBI | NP_055513 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti KIAA0489 antibody, anti KIAA0792 antibody, an Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Positive control (+): Human stomach (ST), Negative control (-): Human liver (LI), Antibody concentration: 0.5 ug/mL.
WB Suggested Anti-TMEM63A Antibody Titration: 0.2-1 ug/mL, Positive Control: 293T cell lysate.
WB | |
Bovine, Equine, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Equine, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
Bovine, Equine, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Equine, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
WB | |
Guinea pig, Human, Mouse, Rabbit, Rat, Yeast | |
Rabbit | |
Polyclonal | |
HRP |