Cart summary

You have no items in your shopping cart.

TMEM63A Rabbit Polyclonal Antibody (FITC)

TMEM63A Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2124897

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2124897
CategoryAntibodies
DescriptionTMEM63A Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Predicted ReactivityGuinea pig, Human, Mouse, Rabbit, Rat, Yeast
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TMEM63A
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW89kDa
UniProt IDO94886
Protein SequenceSynthetic peptide located within the following region: MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP
NCBINP_055513
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesHLD19, KIAA0792
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.