Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

TMEM30A Rabbit Polyclonal Antibody

SKU: orb325344

Description

Rabbit polyclonal antibody to TMEM30A

Research Area

Cell Biology, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human TMEM30A
TargetTMEM30A
Protein SequenceSynthetic peptide located within the following region: FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC
Molecular Weight41 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti C6orf67 antibody, anti CDC50A antibody, anti FLJ10856 antibody

Similar Products

  • TMEM30A Rabbit Polyclonal Antibody [orb1816892]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Human, Porcine, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Transmembrane protein 30A Rabbit Polyclonal Antibody [orb186296]

    IF,  IHC-Fr,  IHC-P

    Bovine, Human, Porcine, Rabbit

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Transmembrane protein 30A Polyclonal Antibody [orb1419312]

    ELISA,  ICC,  IF,  IHC-Fr,  IHC-P

    Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • TMEM30A Rabbit Polyclonal Antibody (HRP) [orb2115737]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

    Rabbit

    Polyclonal

    HRP

    100 μl
  • TMEM30A Rabbit Polyclonal Antibody (Biotin) [orb2115739]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

    Rabbit

    Polyclonal

    Biotin

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

TMEM30A Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Peptide present in canonical 41 kDa protein as well as a 37 kDa and 28 kDa isoforms.

TMEM30A Rabbit Polyclonal Antibody

Sample Type: 293T Whole Cell lysates, Antibody Dilution: 1 ug/mL.

TMEM30A Rabbit Polyclonal Antibody

Sample Type: 721_B, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

TMEM30A Rabbit Polyclonal Antibody

Positive control (+): Stomach tumor (T-ST), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/mL.

TMEM30A Rabbit Polyclonal Antibody

Rabbit Anti-TMEM30A Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

TMEM30A Rabbit Polyclonal Antibody

WB Suggested Anti-TMEM30A Antibody Titration: 1 ug/mL, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_060717

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

TMEM30A Rabbit Polyclonal Antibody (orb325344)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry