Cart summary

You have no items in your shopping cart.

TMEM30A Rabbit Polyclonal Antibody (FITC)

TMEM30A Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2115738

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2115738
CategoryAntibodies
DescriptionTMEM30A Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human TMEM30A
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW41kDa
UniProt IDQ9NV96
Protein SequenceSynthetic peptide located within the following region: FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC
NCBINP_060717
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesCDC50A, C6orf67
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.