You have no items in your shopping cart.
TLR2 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IF, IHC-P, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rat, Sheep, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TLR2 |
| Target | TLR2 |
| Protein Sequence | Synthetic peptide located within the following region: LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS |
| Molecular Weight | 90 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−TLR2 Rabbit Polyclonal Antibody [orb11487]
FC, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlTLR2 Rabbit Polyclonal Antibody [orb186268]
FC, WB
Canine
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlTLR4 Antibody (PerCP) [orb152206]
FACS, FC, ICC, IF, IHC, WB
Human, Mouse
Rabbit
Polyclonal
PerCP
100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: Human Macrophange Cells, Green: primary, Red: phallodin, Blue: DAPI, Yellow: green/red, Primary dilution: 1:200, Secondary Antibody: anti-Rabbit IgG-FITC, Secondary dilution: 1:1000.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 0.05 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 23 kDa.

Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.

Sample Tissue: Human OVCAR-3, Antibody dilution: 1.0 ug/ml.

Sample Type: 786-0 Whole Cell lysates, Antibody dilution: 0.05 ug/ml.

IF Information: human macrophages.

IHC Information: Lung.

Immunohistochemistry with Liver tissue at an antibody concentration of 5.0 ug/ml using anti-TLR2 antibody (orb573647).

Immunohistochemistry with pFA fixed human thymus tissue.

TLR2 antibody - C-terminal region (orb573647) validated by WB using Fetal Brain Lysate at 1 ug/ml.
Documents Download
Request a Document
Protocol Information
Filter by Applications
B. Sayyaf Dezfuli a, F. Pironi a, G. Castaldelli b, L. Giari b, M. Lanzoni b, K. Buchmann c, P.W. Kania c, G. Bosi Anguilla anguilla vs Contracaecum rudolphii: Granuloma allows host tolerance and parasite survival Aquaculture, (2024)
Applications
TLR2 Rabbit Polyclonal Antibody (orb573647)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





















