Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

TLR2 Rabbit Polyclonal Antibody

SKU: orb573647

Description

Rabbit polyclonal antibody to TLR2

Research Area

Immunology & Inflammation

Images & Validation

Tested ApplicationsIF, IHC-P, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human TLR2
TargetTLR2
Protein SequenceSynthetic peptide located within the following region: LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS
Molecular Weight90 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

TIL4, CD282

Similar Products

  • TLR2 Rabbit Polyclonal Antibody [orb191498]

    ELISA,  ICC,  IF,  IHC-P,  WB

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • TLR2 Rabbit Polyclonal Antibody [orb11487]

    FC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • TLR2 Rabbit Polyclonal Antibody [orb389305]

    ICC,  IF,  IHC-P,  WB

    Guinea pig, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • TLR2 Rabbit Polyclonal Antibody [orb186268]

    FC,  WB

    Canine

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • TLR4 Antibody (APC) [orb152201]

    FACS,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    APC

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

TLR2 Rabbit Polyclonal Antibody

Sample Type: Human Macrophange Cells, Green: primary, Red: phallodin, Blue: DAPI, Yellow: green/red, Primary dilution: 1:200, Secondary Antibody: anti-Rabbit IgG-FITC, Secondary dilution: 1:1000.

TLR2 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 0.05 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 23 kDa.

TLR2 Rabbit Polyclonal Antibody

Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.

TLR2 Rabbit Polyclonal Antibody

Sample Tissue: Human OVCAR-3, Antibody dilution: 1.0 ug/ml.

TLR2 Rabbit Polyclonal Antibody

Sample Type: 786-0 Whole Cell lysates, Antibody dilution: 0.05 ug/ml.

TLR2 Rabbit Polyclonal Antibody

IF Information: human macrophages.

TLR2 Rabbit Polyclonal Antibody

IHC Information: Lung.

TLR2 Rabbit Polyclonal Antibody

Immunohistochemistry with Liver tissue at an antibody concentration of 5.0 ug/ml using anti-TLR2 antibody (orb573647).

TLR2 Rabbit Polyclonal Antibody

Immunohistochemistry with pFA fixed human thymus tissue.

TLR2 Rabbit Polyclonal Antibody

TLR2 antibody - C-terminal region (orb573647) validated by WB using Fetal Brain Lysate at 1 ug/ml.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003255

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol
IF
Immunofluorescence
View Protocol

Filter by Applications

B. Sayyaf Dezfuli a, F. Pironi a, G. Castaldelli b, L. Giari b, M. Lanzoni b, K. Buchmann c, P.W. Kania c, G. Bosi Anguilla anguilla vs Contracaecum rudolphii: Granuloma allows host tolerance and parasite survival Aquaculture, (2024)

Applications

IHC

TLR2 Rabbit Polyclonal Antibody (orb573647)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry