Timm13 Rabbit Polyclonal Antibody

SKU: orb325940

Description

Rabbit polyclonal antibody to Timm13

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Equine, Guinea pig, Human, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Target: Timm13
• Protein Sequence: Synthetic peptide located within the following region: FGSDFGGTGGGKLDPGAIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKP
• Molecular Weight: 10kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti D10Ertd378e antibody, anti Tim9 antibody, anti Timm9 antibody

Sample Tissue: Mouse Mouse Small Intestine, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-Timm13 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Kidney.

Quick Database Links

Gene Symbol

Timm13

UniProt

P62075

RefSeq (Protein):NP_038923