Timm13 Rabbit Polyclonal Antibody

• Catalog Number: orb325940
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Timm13
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Human, Rat, Zebrafish
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 10kDa
• Target: Timm13
• UniProt ID: P62075
• Protein Sequence: Synthetic peptide located within the following region: FGSDFGGTGGGKLDPGAIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKP
• NCBI: NP_038923
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti D10Ertd378e antibody, anti Tim9 antibody, ant
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Mouse Small Intestine, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-Timm13 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Kidney.