Cart summary

You have no items in your shopping cart.

Timm13 Rabbit Polyclonal Antibody (FITC)

Timm13 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2105889

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2105889
CategoryAntibodies
DescriptionTimm13 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW10kDa
UniProt IDP62075
Protein SequenceSynthetic peptide located within the following region: FGSDFGGTGGGKLDPGAIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKP
NCBINP_038923
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesTim, Tim9, Timm, Timm9, D10Ertd378, D10Ertd378e
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.