You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330155 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TIA1 |
| Target | TIA1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TIA1 |
| Protein Sequence | Synthetic peptide located within the following region: QAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ |
| UniProt ID | P31483 |
| MW | 42 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti TIA-1 antibody |
| Research Area | Cell Biology, Epigenetics & Chromatin, Molecular B Read more... |
| Note | For research use only |
| NCBI | NP_071320 |

50 ug HAP1 WT and TIA1 KO lysates were subjected to SDS-PAGE followed by immunoblotting with an antibody dilution of 1/200. (right) Ponceau S staining to verify protein transfer.

HAP1 WT and TIA1 KO cells were labelled with a green or a far-red fluorescent dye, respectively. WT and KO cells were mixed and plated to a 1:1 ratio in a 96-well plate as a mosaic culture. Cells were stained with orb330155 at a dilution of 1/500. Bars = 10um.

TIA1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb330155 with 1:200 dilution. Western blot was performed using orb330155 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: TIA1 IP with orb330155 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

TIA1 was immunoprecipitated from HAP1 WT cell lysates using 1 ug of orb330155 coupled to Dynabeads. The Ponceau stained transfers of each blot are shown. SM=4% starting material; UB=4% unbound fraction; IP=immunoprecipitated.

WB Suggested Anti-TIA1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Thymus.
IF, IHC-Fr, IHC-P | |
Canine, Equine, Mouse, Porcine, Rabbit | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review