TIA1 Rabbit Polyclonal Antibody

• Catalog Number: orb330155
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TIA1
• Target: TIA1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TIA1
• Protein Sequence: Synthetic peptide located within the following region: QAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ
• UniProt ID: P31483
• MW: 42 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti TIA-1 antibody
• Research Area: Cell Biology, Epigenetics & Chromatin, Molecular B
• Note: For research use only
• NCBI: NP_071320

50 ug HAP1 WT and TIA1 KO lysates were subjected to SDS-PAGE followed by immunoblotting with an antibody dilution of 1/200. (right) Ponceau S staining to verify protein transfer.

HAP1 WT and TIA1 KO cells were labelled with a green or a far-red fluorescent dye, respectively. WT and KO cells were mixed and plated to a 1:1 ratio in a 96-well plate as a mosaic culture. Cells were stained with orb330155 at a dilution of 1/500. Bars = 10um.

TIA1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb330155 with 1:200 dilution. Western blot was performed using orb330155 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: TIA1 IP with orb330155 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

TIA1 was immunoprecipitated from HAP1 WT cell lysates using 1 ug of orb330155 coupled to Dynabeads. The Ponceau stained transfers of each blot are shown. SM=4% starting material; UB=4% unbound fraction; IP=immunoprecipitated.

WB Suggested Anti-TIA1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Thymus.