THRB antibody

• Catalog Number: orb329952
• Category: Antibodies
• Description: Rabbit polyclonal antibody to THRB
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ChIP, WB
• Predicted Reactivity: Animal, Canine, Human, Mouse, Rabbit, Rat, Sheep
• Reactivity: Canine, Equine, Human, Mouse, Rat, Sheep
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human THRB
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 53kDa
• Target: THRB
• UniProt ID: P10828
• Protein Sequence: Synthetic peptide located within the following region: MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK
• NCBI: NP_000452
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ERBA-BETA antibody, anti ERBA2 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Liver tissue using THRB antibody

Western blot analysis of human brain tissue using THRB antibody