THRB Rabbit Polyclonal Antibody

• Catalog Number: orb329952
• Category: Antibodies
• Description: Rabbit polyclonal antibody to THRB
• Target: THRB
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Mouse, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human THRB
• Protein Sequence: Synthetic peptide located within the following region: MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK
• UniProt ID: P10828
• MW: 53kDa
• Tested applications: ChIP, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti ERBA-BETA antibody, anti ERBA2 antibody, anti
• Note: For research use only
• NCBI: NP_000452

Application: ChIP, Sample type: mouse liver tissue, Chromatin Used: 100 ug tissue, Antibody Used: 10 ug.

WB Suggested Anti-THRB Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human brain.