You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329902 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Thrb |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ChIP, WB |
Predicted Reactivity | Mouse, Rat |
Reactivity | Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the n terminal region of mouse Thrb |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 54 |
Target | Thrb |
UniProt ID | P37242 |
Protein Sequence | Synthetic peptide located within the following region: MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIY |
NCBI | NP_033406 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti MGC141269 antibody, anti MGC141270 antibody, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of mouse Muscle tissue using Thrb antibody
Western blot analysis of mouse Liver tissue using Thrb antibody
Western blot analysis of mouse Liver tissue using Thrb antibody
FC, IHC-P, WB | |
Mouse, Rat | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
ChIP, WB | |
Animal, Bovine, Guinea pig, Human, Mouse, Rat | |
Equine, Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating