Thrb Rabbit Polyclonal Antibody

• Catalog Number: orb329902
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Thrb
• Target: Thrb
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of mouse Thrb
• Protein Sequence: Synthetic peptide located within the following region: MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIY
• UniProt ID: P37242
• MW: 54
• Tested applications: ChIP, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti MGC141269 antibody, anti MGC141270 antibody,
• Note: For research use only
• NCBI: NP_033406

Application: ChIP, Sample Type: mouse liver tissue, Chromatin Used: 100 ug tissue, Antibody Used: 10 ug.

Application: ChIP, Sample Type: mouse liver tissue, Chromatin Used: 100 ug tissue, Antibody Used: 10 ug.

WB Suggested Anti-Thrb Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Muscle.