TGM4 Rabbit Polyclonal Antibody

• Catalog Number: orb578339
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TGM4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Guinea pig, Mouse, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TGM4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 77kDa
• Target: TGM4
• UniProt ID: P49221
• Protein Sequence: Synthetic peptide located within the following region: KEDMVFMPDEDERKEYILNDTGCHYVGAARSIKCKPWNFGQFEKNVLDCC
• NCBI: NP_003232
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TGP, hTGP
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

TGM4 antibody - N-terminal region (orb578339), Sample Type: Normal Human Prostate, Primary Antibody Dilution: 2 ug/ml, Color/Signal Descriptions: TGM4 (DAB; brown), nuclei (hematoxylin; blue), Gene Name: TGM4.

TGM4 antibody - N-terminal region (orb578339), Sample Type: Normal Human Prostate, Primary Antibody Dilution: 2 ug/ml, Color/Signal Descriptions: TGM4 (DAB; brown), nuclei (hematoxylin; blue), Gene Name: TGM4.

Sample Type: Normal Human Prostate. Primary Antibody Dilution: 2 ug/ml. Color/Signal Descriptions: TGM4 (DAB; brown), nuclei (hematoxylin; blue), Gene Name: TGM4.

WB Suggested Anti-TGM4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: OVCAR-3 cell lysate. TGM4 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.