TGFB1I1 Rabbit Polyclonal Antibody

• Catalog Number: orb324785
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TGFB1I1
• Target: TGFB1I1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TGFB1I1
• Protein Sequence: Synthetic peptide located within the following region: PRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRS
• UniProt ID: B2R8D5
• MW: 48kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti ARA55 antibody, anti HIC-5 antibody, anti HIC
• Research Area: Cell Biology, Epigenetics & Chromatin, Signal Tran
• Note: For research use only
• NCBI: NP_057011

Immunohistochemistry with Human Tonsil lysate tissue at an antibody concentration of 5.0 ug/mL using anti-TGFB1I1 antibody (orb324785).

WB Suggested Anti-TGFB1I1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Transfected 293T.