You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324475 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TGFB1I1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat |
Reactivity | Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human TGFB1I1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 48kDa |
Target | TGFB1I1 |
UniProt ID | B2R8D5 |
Protein Sequence | Synthetic peptide located within the following region: PEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGR |
NCBI | NP_057011 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti ARA55 antibody, anti HIC-5 antibody, anti HIC Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Placenta tissue using TGFB1I1 antibody
Western blot analysis of human Fetal Muscle tissue using TGFB1I1 antibody
Western blot analysis of human Fetal Lung tissue using TGFB1I1 antibody
Western blot analysis of human Fetal Heart tissue using TGFB1I1 antibody
Western blot analysis of human Lung tissue using TGFB1I1 antibody
Immunohistochemical staining of human Lung tissue using TGFB1I1 antibody
Western blot analysis of human Fetal Heart tissue using TGFB1I1 antibody
Western blot analysis of human Placenta tissue using TGFB1I1 antibody
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating