TGFB1I1 Rabbit Polyclonal Antibody

• Catalog Number: orb324475
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TGFB1I1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TGFB1I1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 48kDa
• Target: TGFB1I1
• UniProt ID: B2R8D5
• Protein Sequence: Synthetic peptide located within the following region: PEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGR
• NCBI: NP_057011
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ARA55 antibody, anti HIC-5 antibody, anti HIC
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-TGFB1I1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Lung.

Human Lung

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

Positive control (+): Human Ovary (OV), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/mL.