TFCP2 Rabbit Polyclonal Antibody

• Catalog Number: orb573720
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TFCP2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFCP2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 57kDa
• Target: TFCP2
• UniProt ID: Q12800
• Protein Sequence: Synthetic peptide located within the following region: YSMSDVLALPIFKQEESSLPPDNENKILPFQYVLCAATSPAVKLHDETLT
• NCBI: NP_005644
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LSF, SEF, LBP1C, LSF1D, TFCP2C
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): 293T Cell Lysate (2T), Negative control (-): HeLa Cell Lysate (HL), Antibody concentration: 1 ug/ml.

Rabbit Anti-TFCP2 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Tonsil, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

TFCP2 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb573720 with 1:200 dilution. Western blot was performed using orb573720 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: TFCP2 IP with orb573720 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-TFCP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.