You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330061 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TFB2M |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TFB2M |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 45kDa |
Target | TFB2M |
UniProt ID | Q9H5Q4 |
Protein Sequence | Synthetic peptide located within the following region: ATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKD |
NCBI | NP_071761 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FLJ22661 antibody, anti FLJ23182 antibody, an Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-TFB2M Antibody Titration: 5.0 ug/mL, ELISA Titer: 1:312500, Positive Control: Transfected 293T.
IHC, WB | |
Equine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |