You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329780 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TFB2M |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Human, Rabbit, Rat |
Reactivity | Equine, Human, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TFB2M |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 45kDa |
Target | TFB2M |
UniProt ID | Q9H5Q4 |
Protein Sequence | Synthetic peptide located within the following region: ECNPGPGILTQALLEAGAKVVALESDKTFIPHLESLGKNLDGKLRVIHCD |
NCBI | NP_071761 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FLJ22661 antibody, anti FLJ23182 antibody, an Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of Transfected 293T tissue using TFB2M antibody
Immunohistochemical staining of human Intestine tissue using TFB2M antibody
Filter by Rating