Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

tatM2NX

SKU: orb1140649

Description

Cell permeable TRPM2 antagonist; Cell penetrating peptides.

Research Area

Pharmacology & Drug Discovery

Images & Validation

Key Properties

MW4354.17 Da
Purity> 95% by hplc
FormulaC190H323N71O45 S
Protein SequenceH-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Ser-Arg-Glu-Pro-Gly-Glu-Met-Leu-Pro-Arg-Lys-Leu-Lys-Arg-Val-Leu-Arg-Gln-Glu-Phe-Trp-Val-OH

Storage & Handling

StorageStore dry, frozen and in the dark
Form/AppearanceFreeze dried solid
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

TP010, YGRKKRRQRRRGSREPGEMLPRKLKRVLRQEFWV, tatM2NX

Similar Products

  • TAT-M2NX [orb2276975]

    4354.11

    5 mg, 50 mg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

1 mg
$ 410.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry