Cart summary

You have no items in your shopping cart.

TAS2R3 Rabbit Polyclonal Antibody (FITC)

TAS2R3 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2088105

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2088105
CategoryAntibodies
DescriptionTAS2R3 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityCanine, Equine, Human
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human TAS2R3
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW35kDa
UniProt IDQ9NYW6
Protein SequenceSynthetic peptide located within the following region: VMVWMLLGALLLSCGSTASLINEFKLYSVFRGIEATRNVTEHFRKKRSEY
NCBINP_058639
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesT2R3
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.