TAS2R3 Rabbit Polyclonal Antibody

• Catalog Number: orb587061
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TAS2R3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TAS2R3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: TAS2R3
• UniProt ID: Q9NYW6
• Protein Sequence: Synthetic peptide located within the following region: VMVWMLLGALLLSCGSTASLINEFKLYSVFRGIEATRNVTEHFRKKRSEY
• NCBI: NP_058639
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: T2R3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Fetal Kidney lysates, Antibody dilution: 1.0 ug/ml.