You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb592962 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TAL1 |
| Target | TAL1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TAL1 |
| Protein Sequence | Synthetic peptide located within the following region: INFLAKLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVL |
| UniProt ID | P17542 |
| MW | 34kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | SCL, TCL5, tal-1, bHLHa17 |
| Research Area | Cancer Biology, Cell Biology, Epigenetics & Chroma Read more... |
| Note | For research use only |
| NCBI | NP_003180 |

Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-TAL1 Antibody, Titration: 5 ug/ml, Positive Control: HepG2 Whole Cell.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review