Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 1 - 2 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name TAF7L antibody
Catalog Number orb330728
Species/HostRabbit
ReactivityCanine, Equine, Guinea pig, Human, Mouse, Porcine, Rat
ConjugationUnconjugated
Tested applicationsWB
Immunogen Synthetic peptide located within the following region: QIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQKN
Target TAF7L
Alternative Names
Product Properties
Form/Appearance Liquid: supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Storage Store at 4°C for up to two weeks. For long term storage, aliquot and store at -20°C, avoid freeze/thaw cycles.
Note For research use only.
Isotype IgG
ClonalityPolyclonal
Purity Affinity Purified
MW 41 kDa
Uniprot ID Q5H9L4-2
NCBI NM_001168474; NP_001161946
Entrez 54457
Product Description

Rabbit polyclonal antibody to TAF7L

Validation Images
Western blot analysis of OVCAR-3 Whole Cell tissue using TAF7L antibody
Western blot analysis of OVCAR-3 Whole Cell tissue using TAF7L antibody
Reviews
Write Your Own Review
You're reviewing:TAF7L antibody - orb330728
Your Rating