You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330728 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TAF7L |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 41kDa |
Target | TAF7L |
UniProt ID | Q5H9L4 |
Protein Sequence | Synthetic peptide located within the following region: QIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQKN |
NCBI | NP_001161946 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti CT40 antibody, anti FLJ23157 antibody, anti T Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-TAF7L Antibody, Titration: 1.0 ug/ml, Positive Control: OVCAR-3 Whole Cell, TAF7L is supported by BioGPS gene expression data to be expressed in OVCAR3.
WB | |
Bovine, Canine, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Porcine, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Human, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |