TAF7L Rabbit Polyclonal Antibody

• Catalog Number: orb329945
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TAF7L
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Human, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse TAF7L
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 42kDa
• Target: TAF7L
• UniProt ID: Q99MW7
• Protein Sequence: Synthetic peptide located within the following region: EGKAERKKYNWKHGITPPLKNVRKKRFRKTTKKLPDVKQVDEINFSEYTQ
• NCBI: NP_083234
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti 50kDa antibody, anti Taf2q antibody, anti 493
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-TAF7L Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:312500, Positive Control: SP2/0 cell lysate.