TAF12 Rabbit Polyclonal Antibody

• Catalog Number: orb333131
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TAF12
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ChIP, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TAF12
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 18kDa
• Target: TAF12
• UniProt ID: Q16514
• Protein Sequence: Synthetic peptide located within the following region: MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRL
• NCBI: NP_005635
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti TAF2J antibody, anti TAFII20 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

WB Suggested Anti-TAF12 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T. TAF12 is supported by BioGPS gene expression data to be expressed in HEK293T.