Taf12 Rabbit Polyclonal Antibody

SKU: orb329597

Description

Rabbit polyclonal antibody to Taf12

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Target: Taf12
• Protein Sequence: Synthetic peptide located within the following region: EVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK
• Molecular Weight: 18kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti 20kDa antibody, anti 2810422D08Rik antibody, anti AW557038 antibody, anti Taf2J antibody

WB Suggested Anti-Taf12 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:7812500, Positive Control: Mouse Spleen.

Quick Database Links

Gene Symbol

Taf12

UniProt

Q16514

RefSeq (Protein):NP_079855